Anti MT-CO2 pAb (ATL-HPA051505 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051505-100

• 
• 

Protein Description: mitochondrially encoded cytochrome c oxidase II
Gene Name: MT-CO2
Alternative Gene Name: CO2, COX2, MTCO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064354: 71%, ENSRNOG00000030371: 71%
Entrez Gene ID: 4513
Uniprot ID: P00403
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEIGPVFT
• Gene Sequence: TDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEIGPVFT
• Gene ID - Mouse: ENSMUSG00000064354
• Gene ID - Rat: ENSRNOG00000030371
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.