Protein Description: methionine sulfoxide reductase B1
Gene Name: MSRB1
Alternative Gene Name: SelR, SelX, SepR, SEPX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075705: 48%, ENSRNOG00000055314: 51%
Entrez Gene ID: 51734
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MSRB1
Alternative Gene Name: SelR, SelX, SepR, SEPX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075705: 48%, ENSRNOG00000055314: 51%
Entrez Gene ID: 51734
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVRGHRGGGGTGAARESREPVPPSSLCLPHSSRGLEASIPGLLPLPGSCH |
Documents & Links for Anti MSRB1 pAb (ATL-HPA069557) | |
Datasheet | Anti MSRB1 pAb (ATL-HPA069557) Datasheet (External Link) |
Vendor Page | Anti MSRB1 pAb (ATL-HPA069557) at Atlas |
Documents & Links for Anti MSRB1 pAb (ATL-HPA069557) | |
Datasheet | Anti MSRB1 pAb (ATL-HPA069557) Datasheet (External Link) |
Vendor Page | Anti MSRB1 pAb (ATL-HPA069557) |