Protein Description: methionine sulfoxide reductase A
Gene Name: MSRA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054733: 90%, ENSRNOG00000012440: 91%
Entrez Gene ID: 4482
Uniprot ID: Q9UJ68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MSRA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054733: 90%, ENSRNOG00000012440: 91%
Entrez Gene ID: 4482
Uniprot ID: Q9UJ68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSTIYPTS |
Documents & Links for Anti MSRA pAb (ATL-HPA075766) | |
Datasheet | Anti MSRA pAb (ATL-HPA075766) Datasheet (External Link) |
Vendor Page | Anti MSRA pAb (ATL-HPA075766) at Atlas |
Documents & Links for Anti MSRA pAb (ATL-HPA075766) | |
Datasheet | Anti MSRA pAb (ATL-HPA075766) Datasheet (External Link) |
Vendor Page | Anti MSRA pAb (ATL-HPA075766) |