Anti MSMP pAb (ATL-HPA055174 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA055174-25
  • Immunohistochemical staining of human placenta shows strong cytoplasmic granular positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & vesicles.
  • Western blot analysis in human cell line PC-3 and human cell line A-431.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: microseminoprotein, prostate associated
Gene Name: MSMP
Alternative Gene Name: PC-3, PSMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078719: 94%, ENSRNOG00000043023: 96%
Entrez Gene ID: 692094
Uniprot ID: Q1L6U9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTLGESWLRKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQ
Gene Sequence FTLGESWLRKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQ
Gene ID - Mouse ENSMUSG00000078719
Gene ID - Rat ENSRNOG00000043023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MSMP pAb (ATL-HPA055174 w/enhanced validation)
Datasheet Anti MSMP pAb (ATL-HPA055174 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MSMP pAb (ATL-HPA055174 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MSMP pAb (ATL-HPA055174 w/enhanced validation)
Datasheet Anti MSMP pAb (ATL-HPA055174 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MSMP pAb (ATL-HPA055174 w/enhanced validation)