Anti MSANTD3 pAb (ATL-HPA062662)

Atlas Antibodies

SKU:
ATL-HPA062662-25
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Myb/SANT-like DNA-binding domain containing 3
Gene Name: MSANTD3
Alternative Gene Name: C9orf30, MGC17337
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039693: 100%, ENSRNOG00000008159: 100%
Entrez Gene ID: 91283
Uniprot ID: Q96H12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNEVHVAKIQQIERECEMAEEEHRIKMEVLNKKKMYWERKLQTFTKEWPVSSFNRPFPNSP
Gene Sequence MNEVHVAKIQQIERECEMAEEEHRIKMEVLNKKKMYWERKLQTFTKEWPVSSFNRPFPNSP
Gene ID - Mouse ENSMUSG00000039693
Gene ID - Rat ENSRNOG00000008159
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MSANTD3 pAb (ATL-HPA062662)
Datasheet Anti MSANTD3 pAb (ATL-HPA062662) Datasheet (External Link)
Vendor Page Anti MSANTD3 pAb (ATL-HPA062662) at Atlas Antibodies

Documents & Links for Anti MSANTD3 pAb (ATL-HPA062662)
Datasheet Anti MSANTD3 pAb (ATL-HPA062662) Datasheet (External Link)
Vendor Page Anti MSANTD3 pAb (ATL-HPA062662)