Anti MS4A2 pAb (ATL-HPA059967 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA059967-25

• 

Protein Description: membrane-spanning 4-domains, subfamily A, member 2
Gene Name: MS4A2
Alternative Gene Name: APY, FCER1B, IGER, MS4A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024680: 66%, ENSRNOG00000020993: 53%
Entrez Gene ID: 2206
Uniprot ID: Q01362
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPID
• Gene Sequence: EELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPID
• Gene ID - Mouse: ENSMUSG00000024680
• Gene ID - Rat: ENSRNOG00000020993
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.