Anti MS4A15 pAb (ATL-HPA054563)
Atlas Antibodies
- SKU:
- ATL-HPA054563-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MS4A15
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067571: 90%, ENSRNOG00000026957: 70%
Entrez Gene ID: 219995
Uniprot ID: Q8N5U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSAAPASNGVFVVIPPNNASGLCPPPAILPTSMCQPPGIMQFEEPPLGAQTPRATQPPDLRPVETFLTGE |
Gene Sequence | MSAAPASNGVFVVIPPNNASGLCPPPAILPTSMCQPPGIMQFEEPPLGAQTPRATQPPDLRPVETFLTGE |
Gene ID - Mouse | ENSMUSG00000067571 |
Gene ID - Rat | ENSRNOG00000026957 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MS4A15 pAb (ATL-HPA054563) | |
Datasheet | Anti MS4A15 pAb (ATL-HPA054563) Datasheet (External Link) |
Vendor Page | Anti MS4A15 pAb (ATL-HPA054563) at Atlas Antibodies |
Documents & Links for Anti MS4A15 pAb (ATL-HPA054563) | |
Datasheet | Anti MS4A15 pAb (ATL-HPA054563) Datasheet (External Link) |
Vendor Page | Anti MS4A15 pAb (ATL-HPA054563) |