Anti MRPS9 pAb (ATL-HPA048479 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048479-25

• 
• 
• 

Protein Description: mitochondrial ribosomal protein S9
Gene Name: MRPS9
Alternative Gene Name: MRP-S9, RPMS9, S9mt
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060679: 91%, ENSRNOG00000016201: 92%
Entrez Gene ID: 64965
Uniprot ID: P82933
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIDYQLYFPITQDREQLMFPFHFVDRLGKHDVTCTVSGGGRSAQAGAIRLAMAKALCSFVTEDEVEWMRQAGLLTTDPRVRERKKPGQEGARRKFTWKK
• Gene Sequence: GIDYQLYFPITQDREQLMFPFHFVDRLGKHDVTCTVSGGGRSAQAGAIRLAMAKALCSFVTEDEVEWMRQAGLLTTDPRVRERKKPGQEGARRKFTWKK
• Gene ID - Mouse: ENSMUSG00000060679
• Gene ID - Rat: ENSRNOG00000016201
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.