Anti MRPS18C pAb (ATL-HPA050404)

Atlas Antibodies

SKU: ATL-HPA050404-25

• 

Protein Description: mitochondrial ribosomal protein S18C
Gene Name: MRPS18C
Alternative Gene Name: CGI-134, FLJ11146, FLJ22967, MRPS18-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016833: 93%, ENSRNOG00000002178: 94%
Entrez Gene ID: 51023
Uniprot ID: Q9Y3D5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYR
• Gene Sequence: HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYR
• Gene ID - Mouse: ENSMUSG00000016833
• Gene ID - Rat: ENSRNOG00000002178
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.