Anti MRPS18B pAb (ATL-HPA050334)

Atlas Antibodies

SKU:
ATL-HPA050334-25
  • Immunohistochemical staining of human cerebellum shows weak cytoplasmic positivity in Purkinje cells, cells in molecular layer and granular layer).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S18B
Gene Name: MRPS18B
Alternative Gene Name: C6orf14, HSPC183, MRPS18-2, PTD017
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024436: 69%, ENSRNOG00000000804: 71%
Entrez Gene ID: 28973
Uniprot ID: Q9Y676
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRK
Gene Sequence ASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRK
Gene ID - Mouse ENSMUSG00000024436
Gene ID - Rat ENSRNOG00000000804
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MRPS18B pAb (ATL-HPA050334)
Datasheet Anti MRPS18B pAb (ATL-HPA050334) Datasheet (External Link)
Vendor Page Anti MRPS18B pAb (ATL-HPA050334) at Atlas Antibodies

Documents & Links for Anti MRPS18B pAb (ATL-HPA050334)
Datasheet Anti MRPS18B pAb (ATL-HPA050334) Datasheet (External Link)
Vendor Page Anti MRPS18B pAb (ATL-HPA050334)