Anti MRPS16 pAb (ATL-HPA054538 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA054538-25
  • Immunohistochemical staining of human kidney shows weak cytoplasmic granular expression in cells in tubules.
  • Western blot analysis using Anti-MRPS16 antibody HPA054538 (A) shows similar pattern to independent antibody HPA050081 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S16
Gene Name: MRPS16
Alternative Gene Name: CGI-132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049960: 94%, ENSRNOG00000006898: 95%
Entrez Gene ID: 51021
Uniprot ID: Q9Y3D3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGE
Gene Sequence MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGE
Gene ID - Mouse ENSMUSG00000049960
Gene ID - Rat ENSRNOG00000006898
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti MRPS16 pAb (ATL-HPA054538 w/enhanced validation)
Datasheet Anti MRPS16 pAb (ATL-HPA054538 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MRPS16 pAb (ATL-HPA054538 w/enhanced validation)



Citations for Anti MRPS16 pAb (ATL-HPA054538 w/enhanced validation) – 1 Found
Clemente, Paula; Calvo-Garrido, Javier; Pearce, Sarah F; Schober, Florian A; Shigematsu, Megumi; Siira, Stefan J; Laine, Isabelle; Spåhr, Henrik; Steinmetzger, Christian; Petzold, Katja; Kirino, Yohei; Wibom, Rolf; Rackham, Oliver; Filipovska, Aleksandra; Rorbach, Joanna; Freyer, Christoph; Wredenberg, Anna. ANGEL2 phosphatase activity is required for non-canonical mitochondrial RNA processing. Nature Communications. 2022;13(1):5750.  PubMed