Anti MRPS14 pAb (ATL-HPA051087)

Atlas Antibodies

SKU:
ATL-HPA051087-25
  • Immunohistochemical staining of human Duodenum shows strong granular cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear membrane & mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S14
Gene Name: MRPS14
Alternative Gene Name: HSMRPS14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058267: 90%, ENSRNOG00000002569: 90%
Entrez Gene ID: 63931
Uniprot ID: O60783
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW
Gene Sequence YADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW
Gene ID - Mouse ENSMUSG00000058267
Gene ID - Rat ENSRNOG00000002569
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MRPS14 pAb (ATL-HPA051087)
Datasheet Anti MRPS14 pAb (ATL-HPA051087) Datasheet (External Link)
Vendor Page Anti MRPS14 pAb (ATL-HPA051087) at Atlas Antibodies

Documents & Links for Anti MRPS14 pAb (ATL-HPA051087)
Datasheet Anti MRPS14 pAb (ATL-HPA051087) Datasheet (External Link)
Vendor Page Anti MRPS14 pAb (ATL-HPA051087)