Anti MRPS12 pAb (ATL-HPA050633)

Atlas Antibodies

SKU: ATL-HPA050633-25

• 

Protein Description: mitochondrial ribosomal protein S12
Gene Name: MRPS12
Alternative Gene Name: RPMS12, RPS12, RPSM12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045948: 91%, ENSRNOG00000019949: 91%
Entrez Gene ID: 6183
Uniprot ID: O15235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEG
• Gene Sequence: PQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEG
• Gene ID - Mouse: ENSMUSG00000045948
• Gene ID - Rat: ENSRNOG00000019949
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.