Anti MRPS11 pAb (ATL-HPA050345)

Atlas Antibodies

SKU:
ATL-HPA050345-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S11
Gene Name: MRPS11
Alternative Gene Name: FLJ22512, FLJ23406, HCC-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030611: 59%, ENSRNOG00000018531: 63%
Entrez Gene ID: 64963
Uniprot ID: P82912
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEP
Gene Sequence SRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEP
Gene ID - Mouse ENSMUSG00000030611
Gene ID - Rat ENSRNOG00000018531
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MRPS11 pAb (ATL-HPA050345)
Datasheet Anti MRPS11 pAb (ATL-HPA050345) Datasheet (External Link)
Vendor Page Anti MRPS11 pAb (ATL-HPA050345) at Atlas Antibodies

Documents & Links for Anti MRPS11 pAb (ATL-HPA050345)
Datasheet Anti MRPS11 pAb (ATL-HPA050345) Datasheet (External Link)
Vendor Page Anti MRPS11 pAb (ATL-HPA050345)