Anti MRPS11 pAb (ATL-HPA043752 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA043752-100
  • Immunohistochemistry analysis in human thyroid gland and pancreas tissues using Anti-MRPS11 antibody. Corresponding MRPS11 RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and MRPS11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406128).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S11
Gene Name: MRPS11
Alternative Gene Name: FLJ22512, FLJ23406, HCC-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030611: 86%, ENSRNOG00000018531: 86%
Entrez Gene ID: 64963
Uniprot ID: P82912
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNG
Gene Sequence GFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNG
Gene ID - Mouse ENSMUSG00000030611
Gene ID - Rat ENSRNOG00000018531
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti MRPS11 pAb (ATL-HPA043752 w/enhanced validation)
Datasheet Anti MRPS11 pAb (ATL-HPA043752 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MRPS11 pAb (ATL-HPA043752 w/enhanced validation)