Anti MRPL54 pAb (ATL-HPA046767)

Atlas Antibodies

SKU:
ATL-HPA046767-25
  • Immunohistochemical staining of human fallopian tube shows cytoplasmic positivity with a granular pattern in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L54
Gene Name: MRPL54
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034932: 84%, ENSRNOG00000020464: 82%
Entrez Gene ID: 116541
Uniprot ID: Q6P161
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL
Gene Sequence CTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL
Gene ID - Mouse ENSMUSG00000034932
Gene ID - Rat ENSRNOG00000020464
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MRPL54 pAb (ATL-HPA046767)
Datasheet Anti MRPL54 pAb (ATL-HPA046767) Datasheet (External Link)
Vendor Page Anti MRPL54 pAb (ATL-HPA046767) at Atlas Antibodies

Documents & Links for Anti MRPL54 pAb (ATL-HPA046767)
Datasheet Anti MRPL54 pAb (ATL-HPA046767) Datasheet (External Link)
Vendor Page Anti MRPL54 pAb (ATL-HPA046767)