Anti MRPL53 pAb (ATL-HPA056185)
Atlas Antibodies
- SKU:
- ATL-HPA056185-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MRPL53
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030037: 93%, ENSRNOG00000053109: 92%
Entrez Gene ID: 116540
Uniprot ID: Q96EL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALE |
Gene Sequence | KQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALE |
Gene ID - Mouse | ENSMUSG00000030037 |
Gene ID - Rat | ENSRNOG00000053109 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MRPL53 pAb (ATL-HPA056185) | |
Datasheet | Anti MRPL53 pAb (ATL-HPA056185) Datasheet (External Link) |
Vendor Page | Anti MRPL53 pAb (ATL-HPA056185) at Atlas Antibodies |
Documents & Links for Anti MRPL53 pAb (ATL-HPA056185) | |
Datasheet | Anti MRPL53 pAb (ATL-HPA056185) Datasheet (External Link) |
Vendor Page | Anti MRPL53 pAb (ATL-HPA056185) |