Anti MRPL53 pAb (ATL-HPA056185)

Atlas Antibodies

SKU:
ATL-HPA056185-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L53
Gene Name: MRPL53
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030037: 93%, ENSRNOG00000053109: 92%
Entrez Gene ID: 116540
Uniprot ID: Q96EL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALE
Gene Sequence KQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALE
Gene ID - Mouse ENSMUSG00000030037
Gene ID - Rat ENSRNOG00000053109
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MRPL53 pAb (ATL-HPA056185)
Datasheet Anti MRPL53 pAb (ATL-HPA056185) Datasheet (External Link)
Vendor Page Anti MRPL53 pAb (ATL-HPA056185) at Atlas Antibodies

Documents & Links for Anti MRPL53 pAb (ATL-HPA056185)
Datasheet Anti MRPL53 pAb (ATL-HPA056185) Datasheet (External Link)
Vendor Page Anti MRPL53 pAb (ATL-HPA056185)