Anti MRPL51 pAb (ATL-HPA039923)

Atlas Antibodies

SKU: ATL-HPA039923-25

• 
• 
• 

Protein Description: mitochondrial ribosomal protein L51
Gene Name: MRPL51
Alternative Gene Name: bMRP64, CDA09, HSPC241, MRP64
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030335: 83%, ENSRNOG00000019165: 85%
Entrez Gene ID: 51258
Uniprot ID: Q4U2R6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNR
• Gene Sequence: GNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNR
• Gene ID - Mouse: ENSMUSG00000030335
• Gene ID - Rat: ENSRNOG00000019165
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.