Anti MRPL49 pAb (ATL-HPA046778)

Atlas Antibodies

SKU: ATL-HPA046778-25

• 

Protein Description: mitochondrial ribosomal protein L49
Gene Name: MRPL49
Alternative Gene Name: C11orf4, L49mt, NOF, NOF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007338: 91%, ENSRNOG00000020975: 94%
Entrez Gene ID: 740
Uniprot ID: Q13405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF
• Gene Sequence: GKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF
• Gene ID - Mouse: ENSMUSG00000007338
• Gene ID - Rat: ENSRNOG00000020975
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.