Anti MRPL46 pAb (ATL-HPA050166)

Atlas Antibodies

SKU:
ATL-HPA050166-25
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L46
Gene Name: MRPL46
Alternative Gene Name: C15orf4, LIECG2, P2ECSL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030612: 88%, ENSRNOG00000018547: 85%
Entrez Gene ID: 26589
Uniprot ID: Q9H2W6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAQDLEDMWEQKFLQFKLGARITEADEKNDRTSLNRKLDRNLVLLVREKFGDQDVWILPQAEWQPGETLRGTAERTLATLSE
Gene Sequence LAQDLEDMWEQKFLQFKLGARITEADEKNDRTSLNRKLDRNLVLLVREKFGDQDVWILPQAEWQPGETLRGTAERTLATLSE
Gene ID - Mouse ENSMUSG00000030612
Gene ID - Rat ENSRNOG00000018547
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MRPL46 pAb (ATL-HPA050166)
Datasheet Anti MRPL46 pAb (ATL-HPA050166) Datasheet (External Link)
Vendor Page Anti MRPL46 pAb (ATL-HPA050166) at Atlas Antibodies

Documents & Links for Anti MRPL46 pAb (ATL-HPA050166)
Datasheet Anti MRPL46 pAb (ATL-HPA050166) Datasheet (External Link)
Vendor Page Anti MRPL46 pAb (ATL-HPA050166)