Anti MRPL4 pAb (ATL-HPA051261)

Atlas Antibodies

SKU: ATL-HPA051261-25

• 
• 
• 

Protein Description: mitochondrial ribosomal protein L4
Gene Name: MRPL4
Alternative Gene Name: CGI-28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003299: 68%, ENSRNOG00000020659: 71%
Entrez Gene ID: 51073
Uniprot ID: Q9BYD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLQFVRAGARAWLRPTGSQGLSSLAEEAARATENPEQVASEGLPEPVLRKVELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLDILHQVA
• Gene Sequence: MLQFVRAGARAWLRPTGSQGLSSLAEEAARATENPEQVASEGLPEPVLRKVELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLDILHQVA
• Gene ID - Mouse: ENSMUSG00000003299
• Gene ID - Rat: ENSRNOG00000020659
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MRPL4 pAb (ATL-HPA051261) – 1 Found

Abshire, Elizabeth T; Hughes, Kelsey L; Diao, Rucheng; Pearce, Sarah; Gopalakrishna, Shreekara; Trievel, Raymond C; Rorbach, Joanna; Freddolino, Peter L; Goldstrohm, Aaron C. Differential processing and localization of human Nocturnin controls metabolism of mRNA and nicotinamide adenine dinucleotide cofactors. The Journal Of Biological Chemistry. 2020;295(44):15112-15133.