Anti MRPL36 pAb (ATL-HPA047238)

Atlas Antibodies

SKU: ATL-HPA047238-25

• 
• 

Protein Description: mitochondrial ribosomal protein L36
Gene Name: MRPL36
Alternative Gene Name: BRIP1, L36mt, MRP-L36, PRPL36, RPMJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021607: 65%, ENSRNOG00000047971: 63%
Entrez Gene ID: 64979
Uniprot ID: Q9P0J6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM
• Gene Sequence: PVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM
• Gene ID - Mouse: ENSMUSG00000021607
• Gene ID - Rat: ENSRNOG00000047971
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.