Anti MRPL34 pAb (ATL-HPA049276)

Atlas Antibodies

SKU:
ATL-HPA049276-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & nuclear bodies.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L34
Gene Name: MRPL34
Alternative Gene Name: L34mt, MGC24974, MGC2633
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034880: 82%, ENSRNOG00000017552: 79%
Entrez Gene ID: 64981
Uniprot ID: Q9BQ48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AALLGGRWLQPRAWLGFPDAWGLPTPQQARGKARGNEYQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSLSH
Gene Sequence AALLGGRWLQPRAWLGFPDAWGLPTPQQARGKARGNEYQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSLSH
Gene ID - Mouse ENSMUSG00000034880
Gene ID - Rat ENSRNOG00000017552
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MRPL34 pAb (ATL-HPA049276)
Datasheet Anti MRPL34 pAb (ATL-HPA049276) Datasheet (External Link)
Vendor Page Anti MRPL34 pAb (ATL-HPA049276) at Atlas Antibodies

Documents & Links for Anti MRPL34 pAb (ATL-HPA049276)
Datasheet Anti MRPL34 pAb (ATL-HPA049276) Datasheet (External Link)
Vendor Page Anti MRPL34 pAb (ATL-HPA049276)