Protein Description: mitochondrial ribosomal protein L33
Gene Name: MRPL33
Alternative Gene Name: C2orf1, RPL33L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106918: 76%, ENSRNOG00000025388: 78%
Entrez Gene ID: 9553
Uniprot ID: O75394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MRPL33
Alternative Gene Name: C2orf1, RPL33L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106918: 76%, ENSRNOG00000025388: 78%
Entrez Gene ID: 9553
Uniprot ID: O75394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MFLSAVFFAKSKSKNILVRMVSEAGTGFCFNTKRNRLREKLTLLHYDPVVKQRVLFVE |
| Documents & Links for Anti MRPL33 pAb (ATL-HPA066872) | |
| Datasheet | Anti MRPL33 pAb (ATL-HPA066872) Datasheet (External Link) |
| Vendor Page | Anti MRPL33 pAb (ATL-HPA066872) at Atlas |
| Documents & Links for Anti MRPL33 pAb (ATL-HPA066872) | |
| Datasheet | Anti MRPL33 pAb (ATL-HPA066872) Datasheet (External Link) |
| Vendor Page | Anti MRPL33 pAb (ATL-HPA066872) |