Anti MRPL30 pAb (ATL-HPA047255)

Atlas Antibodies

SKU:
ATL-HPA047255-25
  • Immunohistochemical staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L30
Gene Name: MRPL30
Alternative Gene Name: MRP-L28, RPML28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026087: 89%, ENSRNOG00000049330: 89%
Entrez Gene ID: 51263
Uniprot ID: Q8TCC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQK
Gene Sequence AHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQK
Gene ID - Mouse ENSMUSG00000026087
Gene ID - Rat ENSRNOG00000049330
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MRPL30 pAb (ATL-HPA047255)
Datasheet Anti MRPL30 pAb (ATL-HPA047255) Datasheet (External Link)
Vendor Page Anti MRPL30 pAb (ATL-HPA047255) at Atlas Antibodies

Documents & Links for Anti MRPL30 pAb (ATL-HPA047255)
Datasheet Anti MRPL30 pAb (ATL-HPA047255) Datasheet (External Link)
Vendor Page Anti MRPL30 pAb (ATL-HPA047255)