Anti MRPL22 pAb (ATL-HPA047063)

Atlas Antibodies

SKU:
ATL-HPA047063-25
  • Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L22
Gene Name: MRPL22
Alternative Gene Name: HSPC158, MRP-L25, RPML25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020514: 94%, ENSRNOG00000027039: 93%
Entrez Gene ID: 29093
Uniprot ID: Q9NWU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IKEVLLQAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL
Gene Sequence IKEVLLQAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL
Gene ID - Mouse ENSMUSG00000020514
Gene ID - Rat ENSRNOG00000027039
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MRPL22 pAb (ATL-HPA047063)
Datasheet Anti MRPL22 pAb (ATL-HPA047063) Datasheet (External Link)
Vendor Page Anti MRPL22 pAb (ATL-HPA047063) at Atlas Antibodies

Documents & Links for Anti MRPL22 pAb (ATL-HPA047063)
Datasheet Anti MRPL22 pAb (ATL-HPA047063) Datasheet (External Link)
Vendor Page Anti MRPL22 pAb (ATL-HPA047063)