Anti MRPL20 pAb (ATL-HPA047074 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA047074-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to mitochondria.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and MRPL20 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413405).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L20
Gene Name: MRPL20
Alternative Gene Name: FLJ10024
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029066: 91%, ENSRNOG00000018647: 91%
Entrez Gene ID: 55052
Uniprot ID: Q9BYC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH
Gene Sequence ASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH
Gene ID - Mouse ENSMUSG00000029066
Gene ID - Rat ENSRNOG00000018647
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti MRPL20 pAb (ATL-HPA047074 w/enhanced validation)
Datasheet Anti MRPL20 pAb (ATL-HPA047074 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MRPL20 pAb (ATL-HPA047074 w/enhanced validation)