Anti MRPL19 pAb (ATL-HPA056622)

Atlas Antibodies

SKU: ATL-HPA056622-25

• 
• 

Protein Description: mitochondrial ribosomal protein L19
Gene Name: MRPL19
Alternative Gene Name: KIAA0104, MRP-L15, RLX1, RPML15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030045: 87%, ENSRNOG00000006968: 85%
Entrez Gene ID: 9801
Uniprot ID: P49406
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKPVVQEPNQKVPVNELKVKMKPKPWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSKIEAAIWKE
• Gene Sequence: MKPVVQEPNQKVPVNELKVKMKPKPWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSKIEAAIWKE
• Gene ID - Mouse: ENSMUSG00000030045
• Gene ID - Rat: ENSRNOG00000006968
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.