Anti MRPL17 pAb (ATL-HPA050552)

Atlas Antibodies

SKU:
ATL-HPA050552-25
  • Immunohistochemical staining of human breast shows strong cytoplasmic positivity in granular pattern glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L17
Gene Name: MRPL17
Alternative Gene Name: MRP-L26, RPML26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030879: 94%, ENSRNOG00000019497: 95%
Entrez Gene ID: 63875
Uniprot ID: Q9NRX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSVAAAISHGRVFRRMGLGPESRIHLLRNLLTGLVRHERIEAPWARVDEMRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLI
Gene Sequence LSVAAAISHGRVFRRMGLGPESRIHLLRNLLTGLVRHERIEAPWARVDEMRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLI
Gene ID - Mouse ENSMUSG00000030879
Gene ID - Rat ENSRNOG00000019497
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MRPL17 pAb (ATL-HPA050552)
Datasheet Anti MRPL17 pAb (ATL-HPA050552) Datasheet (External Link)
Vendor Page Anti MRPL17 pAb (ATL-HPA050552) at Atlas Antibodies

Documents & Links for Anti MRPL17 pAb (ATL-HPA050552)
Datasheet Anti MRPL17 pAb (ATL-HPA050552) Datasheet (External Link)
Vendor Page Anti MRPL17 pAb (ATL-HPA050552)