Anti MROH8 pAb (ATL-HPA060298)

Atlas Antibodies

SKU:
ATL-HPA060298-25
  • Immunohistochemical staining of human fallopian tube shows distinct membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: maestro heat-like repeat family member 8
Gene Name: MROH8
Alternative Gene Name: C20orf131, C20orf132, dJ621N11.3, dJ621N11.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074627: 63%, ENSRNOG00000007341: 65%
Entrez Gene ID: 140699
Uniprot ID: Q9H579
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPLSHSPRHLTQQDPLSEAIVEKLIQSIQKVFNGELKGELEKLKFLGDLSSLSQALPHDETAKSFIHSHIADIVHTLNVLVQEERPHSLSSSMRQEVFVTIAD
Gene Sequence EPLSHSPRHLTQQDPLSEAIVEKLIQSIQKVFNGELKGELEKLKFLGDLSSLSQALPHDETAKSFIHSHIADIVHTLNVLVQEERPHSLSSSMRQEVFVTIAD
Gene ID - Mouse ENSMUSG00000074627
Gene ID - Rat ENSRNOG00000007341
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MROH8 pAb (ATL-HPA060298)
Datasheet Anti MROH8 pAb (ATL-HPA060298) Datasheet (External Link)
Vendor Page Anti MROH8 pAb (ATL-HPA060298) at Atlas Antibodies

Documents & Links for Anti MROH8 pAb (ATL-HPA060298)
Datasheet Anti MROH8 pAb (ATL-HPA060298) Datasheet (External Link)
Vendor Page Anti MROH8 pAb (ATL-HPA060298)