Anti MROH2A pAb (ATL-HPA052107)

Atlas Antibodies

SKU: ATL-HPA052107-25

• 

Protein Description: maestro heat-like repeat family member 2A
Gene Name: MROH2A
Alternative Gene Name: HEATR7B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079429: 89%, ENSRNOG00000042182: 92%
Entrez Gene ID: 339766
Uniprot ID: A6NES4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVLNVLHDFEERIQESEQSWQISAWRKDHPWRRETVKSALMVMYSCVASYCHPQLLLNLVDSPITAKIIHHYV
• Gene Sequence: TVLNVLHDFEERIQESEQSWQISAWRKDHPWRRETVKSALMVMYSCVASYCHPQLLLNLVDSPITAKIIHHYV
• Gene ID - Mouse: ENSMUSG00000079429
• Gene ID - Rat: ENSRNOG00000042182
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.