Anti MRGPRX2 pAb (ATL-HPA055220)
Atlas Antibodies
- SKU:
- ATL-HPA055220-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MRGPRX2
Alternative Gene Name: MRGX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058301: 37%, ENSRNOG00000014266: 43%
Entrez Gene ID: 117194
Uniprot ID: Q96LB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALQRALQDIAEVDHSEGCFRQGTPEMSRSS |
Gene Sequence | ALQRALQDIAEVDHSEGCFRQGTPEMSRSS |
Gene ID - Mouse | ENSMUSG00000058301 |
Gene ID - Rat | ENSRNOG00000014266 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MRGPRX2 pAb (ATL-HPA055220) | |
Datasheet | Anti MRGPRX2 pAb (ATL-HPA055220) Datasheet (External Link) |
Vendor Page | Anti MRGPRX2 pAb (ATL-HPA055220) at Atlas Antibodies |
Documents & Links for Anti MRGPRX2 pAb (ATL-HPA055220) | |
Datasheet | Anti MRGPRX2 pAb (ATL-HPA055220) Datasheet (External Link) |
Vendor Page | Anti MRGPRX2 pAb (ATL-HPA055220) |