Protein Description: myelin protein zero-like 1
Gene Name: MPZL1
Alternative Gene Name: FLJ21047, PZR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026566: 91%, ENSRNOG00000003248: 91%
Entrez Gene ID: 9019
Uniprot ID: O95297
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MPZL1
Alternative Gene Name: FLJ21047, PZR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026566: 91%, ENSRNOG00000003248: 91%
Entrez Gene ID: 9019
Uniprot ID: O95297
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN |
Documents & Links for Anti MPZL1 pAb (ATL-HPA063538) | |
Datasheet | Anti MPZL1 pAb (ATL-HPA063538) Datasheet (External Link) |
Vendor Page | Anti MPZL1 pAb (ATL-HPA063538) at Atlas |
Documents & Links for Anti MPZL1 pAb (ATL-HPA063538) | |
Datasheet | Anti MPZL1 pAb (ATL-HPA063538) Datasheet (External Link) |
Vendor Page | Anti MPZL1 pAb (ATL-HPA063538) |