Anti MPST pAb (ATL-HPA001240 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001240-100

• 
• 
• 

Protein Description: mercaptopyruvate sulfurtransferase
Gene Name: MPST
Alternative Gene Name: MST, TST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071711: 81%, ENSRNOG00000000185: 82%
Entrez Gene ID: 4357
Uniprot ID: P25325
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPD
• Gene Sequence: AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPD
• Gene ID - Mouse: ENSMUSG00000071711
• Gene ID - Rat: ENSRNOG00000000185
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MPST pAb (ATL-HPA001240 w/enhanced validation) – 18 Found

Sollanek, Kurt J; Burniston, Jatin G; Kavazis, Andreas N; Morton, Aaron B; Wiggs, Michael P; Ahn, Bumsoo; Smuder, Ashley J; Powers, Scott K. Global Proteome Changes in the Rat Diaphragm Induced by Endurance Exercise Training. Plos One. 12(1):e0171007. 

Bai, Xiaopeng; Ihara, Eikichi; Hirano, Katsuya; Tanaka, Yoshimasa; Nakano, Kayoko; Kita, Satomi; Iwamoto, Takahiro; Ogino, Haruei; Hirano, Mayumi; Oda, Yoshinao; Nakamura, Kazuhiko; Ogawa, Yoshihiro. Endogenous Hydrogen Sulfide Contributes to Tone Generation in Porcine Lower Esophageal Sphincter Via Na(+)/Ca(2+) Exchanger. Cellular And Molecular Gastroenterology And Hepatology. 2018;5(3):209-221. 

Nunes, Sofia C; Ramos, Cristiano; Santos, Inês; Mendes, Cindy; Silva, Fernanda; Vicente, João B; Pereira, Sofia A; Félix, Ana; Gonçalves, Luís G; Serpa, Jacinta. Cysteine Boosts Fitness Under Hypoxia-Mimicked Conditions in Ovarian Cancer by Metabolic Reprogramming. Frontiers In Cell And Developmental Biology. 9( 34458274):722412. 

Ueda, Erika; Ohta, Tomoko; Konno, Ayumu; Hirai, Hirokazu; Kurauchi, Yuki; Katsuki, Hiroshi; Seki, Takahiro. D-Cysteine Activates Chaperone-Mediated Autophagy in Cerebellar Purkinje Cells via the Generation of Hydrogen Sulfide and Nrf2 Activation. Cells. 2022;11(7) 

Shibuya, Norihiro; Mikami, Yoshinori; Kimura, Yuka; Nagahara, Noriyuki; Kimura, Hideo. Vascular endothelium expresses 3-mercaptopyruvate sulfurtransferase and produces hydrogen sulfide. Journal Of Biochemistry. 2009;146(5):623-6. 

Rashid, S; Heer, J K; Garle, M J; Alexander, S P H; Roberts, R E. Hydrogen sulphide-induced relaxation of porcine peripheral bronchioles. British Journal Of Pharmacology. 2013;168(8):1902-10. 

Ahmad, Akbar; Gerö, Domokos; Olah, Gabor; Szabo, Csaba. Effect of endotoxemia in mice genetically deficient in cystathionine-γ-lyase, cystathionine-β-synthase or 3-mercaptopyruvate sulfurtransferase. International Journal Of Molecular Medicine. 2016;38(6):1683-1692. 

Hine, Christopher; Kim, Hyo-Jeong; Zhu, Yan; Harputlugil, Eylul; Longchamp, Alban; Matos, Marina Souza; Ramadoss, Preeti; Bauerle, Kevin; Brace, Lear; Asara, John M; Ozaki, C Keith; Cheng, Sheue-Yann; Singha, Subhankar; Ahn, Kyo Han; Kimmelman, Alec; Fisher, Ffolliott M; Pissios, Pavlos; Withers, Dominic J; Selman, Colin; Wang, Rui; Yen, Kelvin; Longo, Valter D; Cohen, Pinchas; Bartke, Andrzej; Kopchick, John J; Miller, Richard; Hollenberg, Anthony N; Mitchell, James R. Hypothalamic-Pituitary Axis Regulates Hydrogen Sulfide Production. Cell Metabolism. 2017;25(6):1320-1333.e5. 

Abdollahi Govar, Armita; Törő, Gábor; Szaniszlo, Peter; Pavlidou, Athanasia; Bibli, Sofia-Iris; Thanki, Ketan; Resto, Vicente A; Chao, Celia; Hellmich, Mark R; Szabo, Csaba; Papapetropoulos, Andreas; Módis, Katalin. 3-Mercaptopyruvate sulfurtransferase supports endothelial cell angiogenesis and bioenergetics. British Journal Of Pharmacology. 2020;177(4):866-883. 

Yuan, Chao; Hou, Hai-Tao; Chen, Huan-Xin; Wang, Jun; Wang, Zheng-Qing; Chen, Tie-Nan; Novakovic, Aleksandra; Marinko, Marija; Yang, Qin; Liu, Zhi-Gang; He, Guo-Wei. Hydrogen sulfide-mediated endothelial function and the interaction with eNOS and PDE5A activity in human internal mammary arteries. The Journal Of International Medical Research. 2019;47(8):3778-3791. 

Morales-Loredo, Humberto; Barrera, Adelaeda; Garcia, Joshua M; Pace, Carolyn E; Naik, Jay S; Gonzalez Bosc, Laura V; Kanagy, Nancy L. Hydrogen sulfide regulation of renal and mesenteric blood flow. American Journal Of Physiology. Heart And Circulatory Physiology. 2019;317(5):H1157-H1165. 

Katsouda, Antonia; Peleli, Maria; Asimakopoulou, Antonia; Papapetropoulos, Andreas; Beis, Dimitris. Generation and Characterization of a CRISPR/Cas9 -Induced 3-mst Deficient Zebrafish. Biomolecules. 2020;10(2) 

González-García, Pilar; Hidalgo-Gutiérrez, Agustín; Mascaraque, Cristina; Barriocanal-Casado, Eliana; Bakkali, Mohammed; Ziosi, Marcello; Abdihankyzy, Ussipbek Botagoz; Sánchez-Hernández, Sabina; Escames, Germaine; Prokisch, Holger; Martín, Francisco; Quinzii, Catarina M; López, Luis C. Coenzyme Q10 modulates sulfide metabolism and links the mitochondrial respiratory chain to pathways associated to one carbon metabolism. Human Molecular Genetics. 2020;29(19):3296-3311. 

Trautwein, Britta; Merz, Tamara; Denoix, Nicole; Szabo, Csaba; Calzia, Enrico; Radermacher, Peter; McCook, Oscar. ΔMST and the Regulation of Cardiac CSE and OTR Expression in Trauma and Hemorrhage. Antioxidants (Basel, Switzerland). 2021;10(2) 

Katsouda, Antonia; Valakos, Dimitrios; Dionellis, Vasilios S; Bibli, Sofia-Iris; Akoumianakis, Ioannis; Karaliota, Sevasti; Zuhra, Karim; Fleming, Ingrid; Nagahara, Noriyuki; Havaki, Sophia; Gorgoulis, Vassilis G; Thanos, Dimitris; Antoniades, Charalambos; Szabo, Csaba; Papapetropoulos, Andreas. MPST sulfurtransferase maintains mitochondrial protein import and cellular bioenergetics to attenuate obesity. The Journal Of Experimental Medicine. 2022;219(7) 

Jiang, Xiaofeng; MacArthur, Michael R; Treviño-Villarreal, J Humberto; Kip, Peter; Ozaki, C Keith; Mitchell, Sarah J; Mitchell, James R. Intracellular H(2)S production is an autophagy-dependent adaptive response to DNA damage. Cell Chemical Biology. 2021;28(12):1669-1678.e5. 

Zivanovic, Jasmina; Kouroussis, Emilia; Kohl, Joshua B; Adhikari, Bikash; Bursac, Biljana; Schott-Roux, Sonia; Petrovic, Dunja; Miljkovic, Jan Lj; Thomas-Lopez, Daniel; Jung, Youngeun; Miler, Marko; Mitchell, Sarah; Milosevic, Verica; Gomes, Jose Eduardo; Benhar, Moran; Gonzalez-Zorn, Bruno; Ivanovic-Burmazovic, Ivana; Torregrossa, Roberta; Mitchell, James R; Whiteman, Matthew; Schwarz, Guenter; Snyder, Solomon H; Paul, Bindu D; Carroll, Kate S; Filipovic, Milos R. Selective Persulfide Detection Reveals Evolutionarily Conserved Antiaging Effects of S-Sulfhydration. Cell Metabolism. 2019;30(6):1152-1170.e13. 

Katsouda, Antonia; Markou, Maria; Zampas, Paraskevas; Varela, Aimilia; Davos, Constantinos H; Vellecco, Valentina; Cirino, Giuseppe; Bucci, Mariarosaria; Papapetropoulos, Andreas. CTH/MPST double ablation results in enhanced vasorelaxation and reduced blood pressure via upregulation of the eNOS/sGC pathway. Frontiers In Pharmacology. 14( 36860295):1090654.