Protein Description: membrane palmitoylated protein 1
Gene Name: MPP1
Alternative Gene Name: DXS552E, PEMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031402: 77%, ENSRNOG00000024631: 27%
Entrez Gene ID: 4354
Uniprot ID: Q00013
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MPP1
Alternative Gene Name: DXS552E, PEMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031402: 77%, ENSRNOG00000024631: 27%
Entrez Gene ID: 4354
Uniprot ID: Q00013
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTE |
Documents & Links for Anti MPP1 pAb (ATL-HPA076675 w/enhanced validation) | |
Datasheet | Anti MPP1 pAb (ATL-HPA076675 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MPP1 pAb (ATL-HPA076675 w/enhanced validation) at Atlas |
Documents & Links for Anti MPP1 pAb (ATL-HPA076675 w/enhanced validation) | |
Datasheet | Anti MPP1 pAb (ATL-HPA076675 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MPP1 pAb (ATL-HPA076675 w/enhanced validation) |