Anti MPP1 pAb (ATL-HPA076675 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA076675-25
  • Immunohistochemistry analysis in human placenta and skin tissues using Anti-MPP1 antibody. Corresponding MPP1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line HEL shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added

Product Description

Protein Description: membrane palmitoylated protein 1
Gene Name: MPP1
Alternative Gene Name: DXS552E, PEMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031402: 77%, ENSRNOG00000024631: 27%
Entrez Gene ID: 4354
Uniprot ID: Q00013
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTE
Gene Sequence MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTE
Gene ID - Mouse ENSMUSG00000031402
Gene ID - Rat ENSRNOG00000024631
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MPP1 pAb (ATL-HPA076675 w/enhanced validation)
Datasheet Anti MPP1 pAb (ATL-HPA076675 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MPP1 pAb (ATL-HPA076675 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MPP1 pAb (ATL-HPA076675 w/enhanced validation)
Datasheet Anti MPP1 pAb (ATL-HPA076675 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MPP1 pAb (ATL-HPA076675 w/enhanced validation)