Anti MPND pAb (ATL-HPA045475)
Atlas Antibodies
- SKU:
- ATL-HPA045475-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MPND
Alternative Gene Name: FLJ14981
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003199: 88%, ENSRNOG00000048282: 86%
Entrez Gene ID: 84954
Uniprot ID: Q8N594
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGW |
Gene Sequence | FHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGW |
Gene ID - Mouse | ENSMUSG00000003199 |
Gene ID - Rat | ENSRNOG00000048282 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MPND pAb (ATL-HPA045475) | |
Datasheet | Anti MPND pAb (ATL-HPA045475) Datasheet (External Link) |
Vendor Page | Anti MPND pAb (ATL-HPA045475) at Atlas Antibodies |
Documents & Links for Anti MPND pAb (ATL-HPA045475) | |
Datasheet | Anti MPND pAb (ATL-HPA045475) Datasheet (External Link) |
Vendor Page | Anti MPND pAb (ATL-HPA045475) |