Anti MPC1 pAb (ATL-HPA045119 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA045119-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MPC1
Alternative Gene Name: BRP44L, CGI-129, dJ68L15.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023861: 100%, ENSRNOG00000012415: 100%
Entrez Gene ID: 51660
Uniprot ID: Q9Y5U8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR |
Gene Sequence | MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR |
Gene ID - Mouse | ENSMUSG00000023861 |
Gene ID - Rat | ENSRNOG00000012415 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MPC1 pAb (ATL-HPA045119 w/enhanced validation) | |
Datasheet | Anti MPC1 pAb (ATL-HPA045119 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MPC1 pAb (ATL-HPA045119 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MPC1 pAb (ATL-HPA045119 w/enhanced validation) | |
Datasheet | Anti MPC1 pAb (ATL-HPA045119 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MPC1 pAb (ATL-HPA045119 w/enhanced validation) |
Citations for Anti MPC1 pAb (ATL-HPA045119 w/enhanced validation) – 15 Found |
Vanderperre, Benoît; Herzig, Sébastien; Krznar, Petra; Hörl, Manuel; Ammar, Zeinab; Montessuit, Sylvie; Pierredon, Sandra; Zamboni, Nicola; Martinou, Jean-Claude. Embryonic Lethality of Mitochondrial Pyruvate Carrier 1 Deficient Mouse Can Be Rescued by a Ketogenic Diet. Plos Genetics. 2016;12(5):e1006056. PubMed |
Vanderperre, Benoît; Cermakova, Kristina; Escoffier, Jessica; Kaba, Mayis; Bender, Tom; Nef, Serge; Martinou, Jean-Claude. MPC1-like Is a Placental Mammal-specific Mitochondrial Pyruvate Carrier Subunit Expressed in Postmeiotic Male Germ Cells. The Journal Of Biological Chemistry. 2016;291(32):16448-61. PubMed |
Lacroix, Matthieu; Rodier, Geneviève; Kirsh, Olivier; Houles, Thibault; Delpech, Hélène; Seyran, Berfin; Gayte, Laurie; Casas, Francois; Pessemesse, Laurence; Heuillet, Maud; Bellvert, Floriant; Portais, Jean-Charles; Berthet, Charlene; Bernex, Florence; Brivet, Michele; Boutron, Audrey; Le Cam, Laurent; Sardet, Claude. E4F1 controls a transcriptional program essential for pyruvate dehydrogenase activity. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(39):10998-1003. PubMed |
Li, Yaqing; Li, Xiaoran; Kan, Quancheng; Zhang, Mingzhi; Li, Xiaoli; Xu, Ruiping; Wang, Junsheng; Yu, Dandan; Goscinski, Mariusz Adam; Wen, Jian-Guo; Nesland, Jahn M; Suo, Zhenhe. Mitochondrial pyruvate carrier function is negatively linked to Warburg phenotype in vitro and malignant features in esophageal squamous cell carcinomas. Oncotarget. 2017;8(1):1058-1073. PubMed |
Shannon, Christopher E; Daniele, Giuseppe; Galindo, Cynthia; Abdul-Ghani, Muhammad A; DeFronzo, Ralph A; Norton, Luke. Pioglitazone inhibits mitochondrial pyruvate metabolism and glucose production in hepatocytes. The Febs Journal. 2017;284(3):451-465. PubMed |
Flores, A; Sandoval-Gonzalez, S; Takahashi, R; Krall, A; Sathe, L; Wei, L; Radu, C; Joly, J H; Graham, N A; Christofk, H R; Lowry, W E. Increased lactate dehydrogenase activity is dispensable in squamous carcinoma cells of origin. Nature Communications. 2019;10(1):91. PubMed |
Hartwig, Cortnie; Méndez, Gretchen Macías; Bhattacharjee, Shatabdi; Vrailas-Mortimer, Alysia D; Zlatic, Stephanie A; Freeman, Amanda A H; Gokhale, Avanti; Concilli, Mafalda; Werner, Erica; Sapp Savas, Christie; Rudin-Rush, Samantha; Palmer, Laura; Shearing, Nicole; Margewich, Lindsey; McArthy, Jacob; Taylor, Savanah; Roberts, Blaine; Lupashin, Vladimir; Polishchuk, Roman S; Cox, Daniel N; Jorquera, Ramon A; Faundez, Victor. Golgi-Dependent Copper Homeostasis Sustains Synaptic Development and Mitochondrial Content. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2021;41(2):215-233. PubMed |
Zhang, Kuan; Yao, Erica; Chen, Biao; Chuang, Ethan; Wong, Julia; Seed, Robert I; Nishimura, Stephen L; Wolters, Paul J; Chuang, Pao-Tien. Acquisition of cellular properties during alveolar formation requires differential activity and distribution of mitochondria. Elife. 2022;11( 35384838) PubMed |
Flores, Aimee; Schell, John; Krall, Abigail S; Jelinek, David; Miranda, Matilde; Grigorian, Melina; Braas, Daniel; White, Andrew C; Zhou, Jessica L; Graham, Nicholas A; Graeber, Thomas; Seth, Pankaj; Evseenko, Denis; Coller, Hilary A; Rutter, Jared; Christofk, Heather R; Lowry, William E. Lactate dehydrogenase activity drives hair follicle stem cell activation. Nature Cell Biology. 2017;19(9):1017-1026. PubMed |
Schell, John C; Wisidagama, Dona R; Bensard, Claire; Zhao, Helong; Wei, Peng; Tanner, Jason; Flores, Aimee; Mohlman, Jeffrey; Sorensen, Lise K; Earl, Christian S; Olson, Kristofor A; Miao, Ren; Waller, T Cameron; Delker, Don; Kanth, Priyanka; Jiang, Lei; DeBerardinis, Ralph J; Bronner, Mary P; Li, Dean Y; Cox, James E; Christofk, Heather R; Lowry, William E; Thummel, Carl S; Rutter, Jared. Control of intestinal stem cell function and proliferation by mitochondrial pyruvate metabolism. Nature Cell Biology. 2017;19(9):1027-1036. PubMed |
Varuzhanyan, Grigor; Rojansky, Rebecca; Sweredoski, Michael J; Graham, Robert L J; Hess, Sonja; Ladinsky, Mark S; Chan, David C. Mitochondrial fusion is required for spermatogonial differentiation and meiosis. Elife. 2019;8( 31596236) PubMed |
Zhu, Huanhuan; Wan, Huiting; Wu, Lin; Li, Qing; Liu, Simeng; Duan, Suyan; Huang, Zhimin; Zhang, Chengning; Zhang, Bo; Xing, Changying; Yuan, Yanggang. Mitochondrial pyruvate carrier: a potential target for diabetic nephropathy. Bmc Nephrology. 2020;21(1):274. PubMed |
De La Rossa, Andres; Laporte, Marine H; Astori, Simone; Marissal, Thomas; Montessuit, Sylvie; Sheshadri, Preethi; Ramos-Fernández, Eva; Mendez, Pablo; Khani, Abbas; Quairiaux, Charles; Taylor, Eric B; Rutter, Jared; Nunes, José Manuel; Carleton, Alan; Duchen, Michael R; Sandi, Carmen; Martinou, Jean-Claude. Paradoxical neuronal hyperexcitability in a mouse model of mitochondrial pyruvate import deficiency. Elife. 2022;11( 35188099) PubMed |
Zhang, Kuan; Yao, Erica; Chuang, Ethan; Chen, Biao; Chuang, Evelyn Y; Chuang, Pao-Tien. mTORC1 signaling facilitates differential stem cell differentiation to shape the developing murine lung and is associated with mitochondrial capacity. Nature Communications. 2022;13(1):7252. PubMed |
Petrelli, Francesco; Scandella, Valentina; Montessuit, Sylvie; Zamboni, Nicola; Martinou, Jean-Claude; Knobloch, Marlen. Mitochondrial pyruvate metabolism regulates the activation of quiescent adult neural stem cells. Science Advances. 2023;9(9):eadd5220. PubMed |