Anti MOSPD3 pAb (ATL-HPA048240)

Atlas Antibodies

SKU: ATL-HPA048240-25

• 
• 

Protein Description: motile sperm domain containing 3
Gene Name: MOSPD3
Alternative Gene Name: CDS3, NET30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037221: 97%, ENSRNOG00000001396: 97%
Entrez Gene ID: 64598
Uniprot ID: O75425
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQ
• Gene Sequence: PLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQ
• Gene ID - Mouse: ENSMUSG00000037221
• Gene ID - Rat: ENSRNOG00000001396
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.