Anti MORN2 pAb (ATL-HPA057815)

Atlas Antibodies

SKU: ATL-HPA057815-25

• 

Protein Description: MORN repeat containing 2
Gene Name: MORN2
Alternative Gene Name: MOPT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045257: 93%, ENSRNOG00000030319: 96%
Entrez Gene ID: 729967
Uniprot ID: Q502X0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLK
• Gene Sequence: MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLK
• Gene ID - Mouse: ENSMUSG00000045257
• Gene ID - Rat: ENSRNOG00000030319
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MORN2 pAb (ATL-HPA057815) – 1 Found

Goel, Manvi; Aponte, Angel M; Wistow, Graeme; Badea, Tudor C. Molecular studies into cell biological role of Copine-4 in Retinal Ganglion Cells. Plos One. 16(11):e0255860.