Anti MORF4L2 pAb (ATL-HPA054102 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054102-25

• 
• 
• 

Protein Description: mortality factor 4 like 2
Gene Name: MORF4L2
Alternative Gene Name: KIAA0026, MRGX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031422: 90%, ENSRNOG00000002389: 90%
Entrez Gene ID: 9643
Uniprot ID: Q15014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRK
• Gene Sequence: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRK
• Gene ID - Mouse: ENSMUSG00000031422
• Gene ID - Rat: ENSRNOG00000002389
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.