Anti MORC4 pAb (ATL-HPA000395 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA000395-25

• 
• 
• 

Protein Description: MORC family CW-type zinc finger 4
Gene Name: MORC4
Alternative Gene Name: FLJ11565, ZCW4, ZCWCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031434: 66%, ENSRNOG00000060846: 67%
Entrez Gene ID: 79710
Uniprot ID: Q8TE76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRLVAEESNRGSTTINKEEVNKGPFVAVVGVAKGVRDSGAPIQLIPFNREELAERRKAVESWNPVPYSVASAAIPAAAIGEKARGYEESEGHNTPKLKNQRELEELKRTTEKLERVLAERNLFQQ
• Gene Sequence: PRLVAEESNRGSTTINKEEVNKGPFVAVVGVAKGVRDSGAPIQLIPFNREELAERRKAVESWNPVPYSVASAAIPAAAIGEKARGYEESEGHNTPKLKNQRELEELKRTTEKLERVLAERNLFQQ
• Gene ID - Mouse: ENSMUSG00000031434
• Gene ID - Rat: ENSRNOG00000060846
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MORC4 pAb (ATL-HPA000395 w/enhanced validation) – 2 Found

Luo, Jing; Zeng, Shiyan; Tian, Chao. MORC4 Promotes Chemoresistance of Luminal A/B Breast Cancer via STAT3-Mediated MID2 Upregulation. Oncotargets And Therapy. 13( 32764967):6795-6803. 

Strack, Elisabeth; Rolfe, P Alexander; Fink, Annika F; Bankov, Katrin; Schmid, Tobias; Solbach, Christine; Savai, Rajkumar; Sha, Weixiao; Pradel, Leon; Hartmann, Sylvia; Brüne, Bernhard; Weigert, Andreas. Identification of tumor-associated macrophage subsets that are associated with breast cancer prognosis. Clinical And Translational Medicine. 2020;10(8):e239.