Anti MON1B pAb (ATL-HPA046285)

Atlas Antibodies

SKU: ATL-HPA046285-100

• 
• 
• 

Protein Description: MON1 secretory trafficking family member B
Gene Name: MON1B
Alternative Gene Name: HSRG1, KIAA0872, SAND2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078908: 60%, ENSRNOG00000011552: 38%
Entrez Gene ID: 22879
Uniprot ID: Q7L1V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVGGDTAAPAPGGAEDLEDTQFPSEEAREGGGVHAVPPDPEDEGLEETGSKDKDQPPSPSPPPQSEALSSTSRL
• Gene Sequence: EVGGDTAAPAPGGAEDLEDTQFPSEEAREGGGVHAVPPDPEDEGLEETGSKDKDQPPSPSPPPQSEALSSTSRL
• Gene ID - Mouse: ENSMUSG00000078908
• Gene ID - Rat: ENSRNOG00000011552
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.