Anti MME pAb (ATL-HPA056072 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA056072-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: MME
Alternative Gene Name: CALLA, CD10, NEP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027820: 92%, ENSRNOG00000009514: 92%
Entrez Gene ID: 4311
Uniprot ID: P08473
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | STVNISITNEEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRN |
Gene Sequence | STVNISITNEEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRN |
Gene ID - Mouse | ENSMUSG00000027820 |
Gene ID - Rat | ENSRNOG00000009514 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MME pAb (ATL-HPA056072 w/enhanced validation) | |
Datasheet | Anti MME pAb (ATL-HPA056072 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MME pAb (ATL-HPA056072 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MME pAb (ATL-HPA056072 w/enhanced validation) | |
Datasheet | Anti MME pAb (ATL-HPA056072 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MME pAb (ATL-HPA056072 w/enhanced validation) |