Anti MME pAb (ATL-HPA056072 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA056072-25

• 

Protein Description: membrane metallo-endopeptidase
Gene Name: MME
Alternative Gene Name: CALLA, CD10, NEP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027820: 92%, ENSRNOG00000009514: 92%
Entrez Gene ID: 4311
Uniprot ID: P08473
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STVNISITNEEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRN
• Gene Sequence: STVNISITNEEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRN
• Gene ID - Mouse: ENSMUSG00000027820
• Gene ID - Rat: ENSRNOG00000009514
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.