Anti MME pAb (ATL-HPA052583 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA052583-25
  • Immunohistochemistry analysis in human small intestine and cerebral cortex tissues using HPA052583 antibody. Corresponding MME RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: membrane metallo-endopeptidase
Gene Name: MME
Alternative Gene Name: CALLA, CD10, NEP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027820: 90%, ENSRNOG00000009514: 90%
Entrez Gene ID: 4311
Uniprot ID: P08473
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK
Gene Sequence VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK
Gene ID - Mouse ENSMUSG00000027820
Gene ID - Rat ENSRNOG00000009514
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MME pAb (ATL-HPA052583 w/enhanced validation)
Datasheet Anti MME pAb (ATL-HPA052583 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MME pAb (ATL-HPA052583 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MME pAb (ATL-HPA052583 w/enhanced validation)
Datasheet Anti MME pAb (ATL-HPA052583 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MME pAb (ATL-HPA052583 w/enhanced validation)