Anti MLX pAb (ATL-HPA052766)

Atlas Antibodies

SKU:
ATL-HPA052766-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: MLX, MAX dimerization protein
Gene Name: MLX
Alternative Gene Name: bHLHd13, MAD7, MXD7, TCFL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017801: 100%, ENSRNOG00000019983: 100%
Entrez Gene ID: 6945
Uniprot ID: Q9UH92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSA
Gene Sequence EEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSA
Gene ID - Mouse ENSMUSG00000017801
Gene ID - Rat ENSRNOG00000019983
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MLX pAb (ATL-HPA052766)
Datasheet Anti MLX pAb (ATL-HPA052766) Datasheet (External Link)
Vendor Page Anti MLX pAb (ATL-HPA052766) at Atlas Antibodies

Documents & Links for Anti MLX pAb (ATL-HPA052766)
Datasheet Anti MLX pAb (ATL-HPA052766) Datasheet (External Link)
Vendor Page Anti MLX pAb (ATL-HPA052766)