Protein Description: myeloid leukemia factor 1
Gene Name: MLF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048416: 75%, ENSRNOG00000012827: 68%
Entrez Gene ID: 4291
Uniprot ID: P58340
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MLF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048416: 75%, ENSRNOG00000012827: 68%
Entrez Gene ID: 4291
Uniprot ID: P58340
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNK |
| Documents & Links for Anti MLF1 pAb (ATL-HPA079339 w/enhanced validation) | |
| Datasheet | Anti MLF1 pAb (ATL-HPA079339 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MLF1 pAb (ATL-HPA079339 w/enhanced validation) at Atlas |
| Documents & Links for Anti MLF1 pAb (ATL-HPA079339 w/enhanced validation) | |
| Datasheet | Anti MLF1 pAb (ATL-HPA079339 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MLF1 pAb (ATL-HPA079339 w/enhanced validation) |