Anti MLANA pAb (ATL-HPA048662 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048662-25

• 
• 

Protein Description: melan-A
Gene Name: MLANA
Alternative Gene Name: MART1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024806: 64%, ENSRNOG00000036608: 67%
Entrez Gene ID: 2315
Uniprot ID: Q16655
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
• Gene Sequence: RRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
• Gene ID - Mouse: ENSMUSG00000024806
• Gene ID - Rat: ENSRNOG00000036608
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MLANA pAb (ATL-HPA048662 w/enhanced validation) – 2 Found

Wang, Y; Zhang, G; Jin, J; Degan, S; Tameze, Y; Zhang, J Y. MALT1 promotes melanoma progression through JNK/c-Jun signaling. Oncogenesis. 2017;6(7):e365. 

Vendramin, Roberto; Katopodi, Vicky; Cinque, Sonia; Konnova, Angelina; Knezevic, Zorica; Adnane, Sara; Verheyden, Yvessa; Karras, Panagiotis; Demesmaeker, Ewout; Bosisio, Francesca M; Kucera, Lukas; Rozman, Jan; Gladwyn-Ng, Ivan; Rizzotto, Lara; Dassi, Erik; Millevoi, Stefania; Bechter, Oliver; Marine, Jean-Christophe; Leucci, Eleonora. Activation of the integrated stress response confers vulnerability to mitoribosome-targeting antibiotics in melanoma. The Journal Of Experimental Medicine. 2021;218(9)