Anti MKRN2OS pAb (ATL-HPA065586)
Atlas Antibodies
- SKU:
- ATL-HPA065586-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MKRN2OS
Alternative Gene Name: C3orf83, MKRN2-AS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068011: 73%, ENSRNOG00000052003: 72%
Entrez Gene ID: 100129480
Uniprot ID: H3BPM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MHCAEAGKALIKFNHCEKYIYSFSVPQCCPLCQQDLGSRKLEDAPVSIANPFTNGHQEKCSFLLRPTQGTFLREY |
Gene Sequence | MHCAEAGKALIKFNHCEKYIYSFSVPQCCPLCQQDLGSRKLEDAPVSIANPFTNGHQEKCSFLLRPTQGTFLREY |
Gene ID - Mouse | ENSMUSG00000068011 |
Gene ID - Rat | ENSRNOG00000052003 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MKRN2OS pAb (ATL-HPA065586) | |
Datasheet | Anti MKRN2OS pAb (ATL-HPA065586) Datasheet (External Link) |
Vendor Page | Anti MKRN2OS pAb (ATL-HPA065586) at Atlas Antibodies |
Documents & Links for Anti MKRN2OS pAb (ATL-HPA065586) | |
Datasheet | Anti MKRN2OS pAb (ATL-HPA065586) Datasheet (External Link) |
Vendor Page | Anti MKRN2OS pAb (ATL-HPA065586) |