Protein Description: MKRN2 opposite strand
Gene Name: MKRN2OS
Alternative Gene Name: C3orf83, MKRN2-AS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068011: 73%, ENSRNOG00000052003: 72%
Entrez Gene ID: 100129480
Uniprot ID: H3BPM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MKRN2OS
Alternative Gene Name: C3orf83, MKRN2-AS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068011: 73%, ENSRNOG00000052003: 72%
Entrez Gene ID: 100129480
Uniprot ID: H3BPM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MHCAEAGKALIKFNHCEKYIYSFSVPQCCPLCQQDLGSRKLEDAPVSIANPFTNGHQEKCSFLLRPTQGTFLREY |
| Documents & Links for Anti MKRN2OS pAb (ATL-HPA065586) | |
| Datasheet | Anti MKRN2OS pAb (ATL-HPA065586) Datasheet (External Link) |
| Vendor Page | Anti MKRN2OS pAb (ATL-HPA065586) at Atlas |
| Documents & Links for Anti MKRN2OS pAb (ATL-HPA065586) | |
| Datasheet | Anti MKRN2OS pAb (ATL-HPA065586) Datasheet (External Link) |
| Vendor Page | Anti MKRN2OS pAb (ATL-HPA065586) |