Anti MITF pAb (ATL-HPA003259 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003259-25

Protein Description: microphthalmia-associated transcription factor
Gene Name: MITF
Alternative Gene Name: bHLHe32, MI, WS2, WS2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035158: 88%, ENSRNOG00000008658: 87%
Entrez Gene ID: 4286
Uniprot ID: O75030
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT
• Gene Sequence: HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT
• Gene ID - Mouse: ENSMUSG00000035158
• Gene ID - Rat: ENSRNOG00000008658
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MITF pAb (ATL-HPA003259 w/enhanced validation) – 15 Found

Lu, Shuyan; Sung, Tae; Lin, Nianwei; Abraham, Robert T; Jessen, Bart A. Lysosomal adaptation: How cells respond to lysosomotropic compounds. Plos One. 12(3):e0173771. 

Steinfeld, Jörg; Steinfeld, Ichie; Bausch, Alexander; Coronato, Nicola; Hampel, Meggi-Lee; Depner, Heike; Layer, Paul G; Vogel-Höpker, Astrid. BMP-induced reprogramming of the neural retina into retinal pigment epithelium requires Wnt signalling. Biology Open. 2017;6(7):979-992. 

Hamm, Michael; Sohier, Pierre; Petit, Valérie; Raymond, Jérémy H; Delmas, Véronique; Le Coz, Madeleine; Gesbert, Franck; Kenny, Colin; Aktary, Zackie; Pouteaux, Marie; Rambow, Florian; Sarasin, Alain; Charoenchon, Nisamanee; Bellacosa, Alfonso; Sanchez-Del-Campo, Luis; Mosteo, Laura; Lauss, Martin; Meijer, Dies; Steingrimsson, Eirikur; Jönsson, Göran B; Cornell, Robert A; Davidson, Irwin; Goding, Colin R; Larue, Lionel. BRN2 is a non-canonical melanoma tumor-suppressor. Nature Communications. 2021;12(1):3707. 

Vendramin, Roberto; Katopodi, Vicky; Cinque, Sonia; Konnova, Angelina; Knezevic, Zorica; Adnane, Sara; Verheyden, Yvessa; Karras, Panagiotis; Demesmaeker, Ewout; Bosisio, Francesca M; Kucera, Lukas; Rozman, Jan; Gladwyn-Ng, Ivan; Rizzotto, Lara; Dassi, Erik; Millevoi, Stefania; Bechter, Oliver; Marine, Jean-Christophe; Leucci, Eleonora. Activation of the integrated stress response confers vulnerability to mitoribosome-targeting antibiotics in melanoma. The Journal Of Experimental Medicine. 2021;218(9) 

Estrada, Charlène; Mirabal-Ortega, Liliana; Méry, Laurence; Dingli, Florent; Besse, Laetitia; Messaoudi, Cedric; Loew, Damarys; Pouponnot, Celio; Bertolotto, Corine; Eychène, Alain; Druillennec, Sabine. MITF activity is regulated by a direct interaction with RAF proteins in melanoma cells. Communications Biology. 2022;5(1):101. 

Webster, Dan E; Barajas, Brook; Bussat, Rose T; Yan, Karen J; Neela, Poornima H; Flockhart, Ross J; Kovalski, Joanna; Zehnder, Ashley; Khavari, Paul A. Enhancer-targeted genome editing selectively blocks innate resistance to oncokinase inhibition. Genome Research. 2014;24(5):751-60. 

Riesenberg, Stefanie; Groetchen, Angela; Siddaway, Robert; Bald, Tobias; Reinhardt, Julia; Smorra, Denise; Kohlmeyer, Judith; Renn, Marcel; Phung, Bengt; Aymans, Pia; Schmidt, Tobias; Hornung, Veit; Davidson, Irwin; Goding, Colin R; Jönsson, Göran; Landsberg, Jennifer; Tüting, Thomas; Hölzel, Michael. MITF and c-Jun antagonism interconnects melanoma dedifferentiation with pro-inflammatory cytokine responsiveness and myeloid cell recruitment. Nature Communications. 2015;6( 26530832):8755. 

Harris, Melissa L; Fufa, Temesgen D; Palmer, Joseph W; Joshi, Sandeep S; Larson, Denise M; Incao, Arturo; Gildea, Derek E; Trivedi, Niraj S; Lee, Autumne N; Day, Chi-Ping; Michael, Helen T; Hornyak, Thomas J; Merlino, Glenn; Pavan, William J. A direct link between MITF, innate immunity, and hair graying. Plos Biology. 2018;16(5):e2003648. 

Louphrasitthiphol, Pakavarin; Ledaki, Ioanna; Chauhan, Jagat; Falletta, Paola; Siddaway, Robert; Buffa, Francesca M; Mole, David R; Soga, Tomoyoshi; Goding, Colin R. MITF controls the TCA cycle to modulate the melanoma hypoxia response. Pigment Cell & Melanoma Research. 2019;32(6):792-808. 

Chen, Feng; Madajewski, Brian; Ma, Kai; Karassawa Zanoni, Daniella; Stambuk, Hilda; Turker, Melik Z; Monette, Sébastien; Zhang, Li; Yoo, Barney; Chen, Peiming; Meester, Richard J C; de Jonge, Sander; Montero, Pablo; Phillips, Evan; Quinn, Thomas P; Gönen, Mithat; Sequeira, Sonia; de Stanchina, Elisa; Zanzonico, Pat; Wiesner, Ulrich; Patel, Snehal G; Bradbury, Michelle S. Molecular phenotyping and image-guided surgical treatment of melanoma using spectrally distinct ultrasmall core-shell silica nanoparticles. Science Advances. 2019;5(12):eaax5208. 

Coe, Elizabeth A; Tan, Jennifer Y; Shapiro, Michael; Louphrasitthiphol, Pakavarin; Bassett, Andrew R; Marques, Ana C; Goding, Colin R; Vance, Keith W. The MITF-SOX10 regulated long non-coding RNA DIRC3 is a melanoma tumour suppressor. Plos Genetics. 2019;15(12):e1008501. 

Johansson, Jeanette A; Marie, Kerrie L; Lu, Yuting; Brombin, Alessandro; Santoriello, Cristina; Zeng, Zhiqiang; Zich, Judith; Gautier, Philippe; von Kriegsheim, Alex; Brunsdon, Hannah; Wheeler, Ann P; Dreger, Marcel; Houston, Douglas R; Dooley, Christopher M; Sims, Andrew H; Busch-Nentwich, Elisabeth M; Zon, Leonard I; Illingworth, Robert S; Patton, E Elizabeth. PRL3-DDX21 Transcriptional Control of Endolysosomal Genes Restricts Melanocyte Stem Cell Differentiation. Developmental Cell. 2020;54(3):317-332.e9. 

Zarei, Mahsa; Giannikou, Krinio; Du, Heng; Liu, Heng-Jia; Duarte, Melissa; Johnson, Sneha; Nassar, Amin H; Widlund, Hans R; Henske, Elizabeth P; Long, Henry W; Kwiatkowski, David J. MITF is a driver oncogene and potential therapeutic target in kidney angiomyolipoma tumors through transcriptional regulation of CYR61. Oncogene. 2021;40(1):112-126. 

Assenmacher, Charles-Antoine; Santagostino, Sara F; Oyama, Mark A; Marine, Jean-Christophe; Bonvin, Elise; Radaelli, Enrico. Classification and Grading of Melanocytic Lesions in a Mouse Model of NRAS-driven Melanomagenesis. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2021;69(3):203-218. 

Dilshat, Ramile; Fock, Valerie; Kenny, Colin; Gerritsen, Ilse; Lasseur, Romain Maurice Jacques; Travnickova, Jana; Eichhoff, Ossia M; Cerny, Philipp; Möller, Katrin; Sigurbjörnsdóttir, Sara; Kirty, Kritika; Einarsdottir, Berglind Ósk; Cheng, Phil F; Levesque, Mitchell; Cornell, Robert A; Patton, E Elizabeth; Larue, Lionel; de Tayrac, Marie; Magnúsdóttir, Erna; Ögmundsdóttir, Margrét Helga; Steingrimsson, Eirikur. MITF reprograms the extracellular matrix and focal adhesion in melanoma. Elife. 2021;10( 33438577)