Anti MISP pAb (ATL-HPA049511 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049511-25

• 
• 
• 

Protein Description: mitotic spindle positioning
Gene Name: MISP
Alternative Gene Name: C19orf21, Caprice, DKFZp686H18209
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035852: 70%, ENSRNOG00000010423: 73%
Entrez Gene ID: 126353
Uniprot ID: Q8IVT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQASGITGSYSVSESPFFSPIHLHSNVAWTVEDPVDSAPPGQRKKEQWYAGINPSDGINSEVLEAIRVTRHKNAMAERWESRIYASEEDD
• Gene Sequence: SQASGITGSYSVSESPFFSPIHLHSNVAWTVEDPVDSAPPGQRKKEQWYAGINPSDGINSEVLEAIRVTRHKNAMAERWESRIYASEEDD
• Gene ID - Mouse: ENSMUSG00000035852
• Gene ID - Rat: ENSRNOG00000010423
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MISP pAb (ATL-HPA049511 w/enhanced validation) – 1 Found

Cormier, Kevin W; Larsen, Brett; Gingras, Anne-Claude; Woodgett, James R. Interactomes of Glycogen Synthase Kinase-3 Isoforms. Journal Of Proteome Research. 2023;22(3):977-989.